Instructions to use area-science-park/ESM3-PPISites with libraries, inference providers, notebooks, and local apps. Follow these links to get started.
- Libraries
- Transformers
How to use area-science-park/ESM3-PPISites with Transformers:
# Use a pipeline as a high-level helper from transformers import pipeline pipe = pipeline("feature-extraction", model="area-science-park/ESM3-PPISites", trust_remote_code=True)# Load model directly from transformers import AutoModel model = AutoModel.from_pretrained("area-science-park/ESM3-PPISites", trust_remote_code=True, device_map="auto") - Notebooks
- Google Colab
- Kaggle
Protein-Protein Interaction Site Prediction
This model is a finetuned version of ESM3-open for protein-protein interaction site prediction. It predicts whether a certain amino acid in a protein sequence is part of an interaction site (1) or not (0).
- ๐ For more details on the training and testing on this model, refer to the pre-print here: https://doi.org/10.64898/2026.05.29.728739.
- ๐ฆ The github repository to use with this model is available here: https://github.com/RitAreaSciencePark/ESM3-PPISites
- ๐ The data for the training and evaluation of this model is available in csv format in this zenodo repository: https://doi.org/10.5281/zenodo.20366948
How to Get Started with the Model
Important note: you need to have access to the esm3-open model (https://huggingface.co/biohub/esm3-sm-open-v1) to use this model.
import torch
from transformers import AutoModel, AutoTokenizer, AutoConfig
from esm.tokenization import get_esm3_model_tokenizers
model_name = "area-science-park/ESM3-PPISites"
model = AutoModel.from_pretrained(model_name, trust_remote_code=True)
tokenizers = get_esm3_model_tokenizers("esm3_sm_open_v1")
sequence_tokenizer = tokenizers.sequence
# move model to device
device = "cuda" if torch.cuda.is_available() else "cpu"
model = model.to(device)
# run over a sample sequence
sequence = "MKTVRQERLKSIVRILEAAKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"
# tokenize
tokens = sequence_tokenizer.encode(sequence)
inputs = torch.tensor(tokens).unsqueeze(0).to(device)
# inference
logits = model(inputs)["logits"]
probabilities = torch.sigmoid(logits)
# get predictions
probabilities
References
Decoding the Grammar of Protein-Protein Interaction Interfaces with Multimodal Representations. Yuri Gardinazzi*, Edith Natalia Villegas Garcia*, Sergio Senci, Davide Di Vora, Antonio Feltrin, Francesca Cuturello. bioRxiv 2026.05.29.728739; doi: https://doi.org/10.64898/2026.05.29.728739
Built with ESM3. License: Cambrian Non-Commercial License Agreement (https://www.evolutionaryscale.ai/policies/cambrian-non-commercial-license-agreement)
- Downloads last month
- 94